DTYMK (NM_012145) Human Recombinant Protein

CAT#: TP301228

Recombinant protein of human deoxythymidylate kinase (thymidylate kinase) (DTYMK), 20 µg

Product Images

Coomassie blue staining of purified DTYMK protein (Cat# TP301228). The protein was produced from HEK293T cells transfected with DTYMK cDNA clone (Cat# RC201228) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201228 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHL
  LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADA
  AKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGEL
  WK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036277
• Locus ID: 1841
• UniProt ID: P23919, Q6FGU2
• Cytogenetics: 2q37.3
• Refseq Size: 1227
• Refseq ORF: 636
• Synonyms: CDC8; PP3731; TMPK; TYMK
• Summary: Catalyzes the conversion of dTMP to dTDP.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Pyrimidine metabolism