OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DTYMK (NM_012145) Human Mass Spec Standard

Be the first to review this product
SKU
PH301228
DTYMK MS Standard C13 and N15-labeled recombinant protein (NP_036277)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503493 DTYMK mouse monoclonal antibody, clone OTI1G8 (formerly 1G8) 100 ul
$447.00
LY415933 Transient overexpression lysate of deoxythymidylate kinase (thymidylate kinase) (DTYMK), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "DTYMK or NM_012145"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201228
Predicted MW 23.8 kDa
Protein Sequence
Protein Sequence
>RC201228 protein sequence
Red=Cloning site Green=Tags(s)

MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHL
LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADA
AKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGEL
WK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036277
RefSeq Size 1227
RefSeq ORF 636
Synonyms CDC8; PP3731; TMPK; TYMK
Locus ID 1841
UniProt ID P23919
Cytogenetics 2q37.3
Summary Catalyzes the conversion of dTMP to dTDP.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DTYMK" proteins (5)
SKU Description Size Price
LC415933 Lyophilized DTYMK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431780 Lyophilized DTYMK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415933 Transient overexpression lysate of deoxythymidylate kinase (thymidylate kinase) (DTYMK), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431780 Transient overexpression lysate of deoxythymidylate kinase (thymidylate kinase) (DTYMK), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301228 Recombinant protein of human deoxythymidylate kinase (thymidylate kinase) (DTYMK), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products