DTYMK (NM_012145) Human Recombinant Protein

SKU
TP301228
Recombinant protein of human deoxythymidylate kinase (thymidylate kinase) (DTYMK), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201228 protein sequence
Red=Cloning site Green=Tags(s)

MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHL
LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADA
AKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGEL
WK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_036277
Locus ID 1841
UniProt ID P23919
Cytogenetics 2q37.3
RefSeq Size 1227
RefSeq ORF 636
Synonyms CDC8; PP3731; TMPK; TYMK
Summary Catalyzes the conversion of dTMP to dTDP.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pyrimidine metabolism
Write Your Own Review
You're reviewing:DTYMK (NM_012145) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301228 DTYMK MS Standard C13 and N15-labeled recombinant protein (NP_036277) 10 ug
$3,255.00
LC415933 DTYMK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431780 DTYMK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415933 Transient overexpression lysate of deoxythymidylate kinase (thymidylate kinase) (DTYMK), transcript variant 1 100 ug
$436.00
LY431780 Transient overexpression lysate of deoxythymidylate kinase (thymidylate kinase) (DTYMK), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.