OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DTYMK (NM_012145) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301228
Recombinant protein of human deoxythymidylate kinase (thymidylate kinase) (DTYMK), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA503493 DTYMK mouse monoclonal antibody, clone OTI1G8 (formerly 1G8) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DTYMK or NM_012145"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201228 protein sequence
Red=Cloning site Green=Tags(s)

MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHL
LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADA
AKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGEL
WK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_036277
Locus ID 1841
UniProt ID P23919
Cytogenetics 2q37.3
RefSeq Size 1227
RefSeq ORF 636
Synonyms CDC8; PP3731; TMPK; TYMK
Summary Catalyzes the conversion of dTMP to dTDP.UniProtKB/Swiss-Prot Function
Protein Categories Growth Factors, Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DTYMK" proteins (5)
SKU Description Size Price
PH301228 DTYMK MS Standard C13 and N15-labeled recombinant protein (NP_036277) 10 ug
$3,360.00
LC415933 Lyophilized DTYMK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431780 Lyophilized DTYMK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415933 Transient overexpression lysate of deoxythymidylate kinase (thymidylate kinase) (DTYMK), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431780 Transient overexpression lysate of deoxythymidylate kinase (thymidylate kinase) (DTYMK), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products