PLAUR (NM_002659) Human Recombinant Protein
CAT#: TP301222
Recombinant protein of human plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201222 protein sequence
Red=Cloning site Green=Tags(s) MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHS EKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSP EEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLP QNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSM NHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Dimerization assay (confocal) (PMID: 25418095) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002650 |
Locus ID | 5329 |
UniProt ID | Q03405 |
Cytogenetics | 19q13.31 |
Refseq Size | 1570 |
Refseq ORF | 1005 |
Synonyms | CD87; U-PAR; UPAR; URKR |
Summary | This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400943 | PLAUR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423709 | PLAUR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423710 | PLAUR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400943 | Transient overexpression lysate of plasminogen activator, urokinase receptor (PLAUR), transcript variant 1 |
USD 436.00 |
|
LY423709 | Transient overexpression lysate of plasminogen activator, urokinase receptor (PLAUR), transcript variant 2 |
USD 436.00 |
|
LY423710 | Transient overexpression lysate of plasminogen activator, urokinase receptor (PLAUR), transcript variant 3 |
USD 436.00 |
|
PH301222 | PLAUR MS Standard C13 and N15-labeled recombinant protein (NP_002650) |
USD 3,255.00 |
|
PH317929 | PLAUR MS Standard C13 and N15-labeled recombinant protein (NP_001005376) |
USD 3,255.00 |
|
TP317929 | Purified recombinant protein of Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 2, 20 µg |
USD 867.00 |
|
TP720329 | Recombinant protein of human plasminogen activator, urokinase receptor (PLAUR), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review