PLAUR (NM_002659) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC201222] |
Predicted MW | 37 kDa |
Protein Sequence |
Protein Sequence
>RC201222 protein sequence
Red=Cloning site Green=Tags(s) MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHS EKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSP EEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLP QNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSM NHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002650 |
RefSeq Size | 1570 |
RefSeq ORF | 1005 |
Synonyms | CD87; U-PAR; UPAR; URKR |
Locus ID | 5329 |
UniProt ID | Q03405 |
Cytogenetics | 19q13.31 |
Summary | This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Complement and coagulation cascades |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH317929 | PLAUR MS Standard C13 and N15-labeled recombinant protein (NP_001005376) | 10 ug |
$3,255.00
|
|
LC400943 | PLAUR HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423709 | PLAUR HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423710 | PLAUR HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400943 | Transient overexpression lysate of plasminogen activator, urokinase receptor (PLAUR), transcript variant 1 | 100 ug |
$436.00
|
|
LY423709 | Transient overexpression lysate of plasminogen activator, urokinase receptor (PLAUR), transcript variant 2 | 100 ug |
$436.00
|
|
LY423710 | Transient overexpression lysate of plasminogen activator, urokinase receptor (PLAUR), transcript variant 3 | 100 ug |
$436.00
|
|
TP301222 | Recombinant protein of human plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP317929 | Purified recombinant protein of Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP720329 | Recombinant protein of human plasminogen activator, urokinase receptor (PLAUR), transcript variant 2 | 10 ug |
$265.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.