Neurogranin (NRGN) (NM_006176) Human Recombinant Protein

CAT#: TP301209

Recombinant protein of human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1, 20 µg

Product Images

Distribution of biomarker concentrations in mild traumatic brain injury (mTBI) and healthy control subjects were measured by a sandwich immunoassay with electrochemiluminescence detection. Box plots show log2-transformed detected serum levels for the American Congress of Rehabilitation Medicine-defined (ACRM+) mTBI patients versus healthy controls. The horizontal black lines represent the median of each distribution; red diamonds indicate the mean for the subgroup. Black dots are individual patients with values 1.5 times beyond the interquartile range and are, therefore, outliers. NRGN protein from OriGene (TP301209) was used to generate a standard curve relating analyte concentration to luminescent signal. Figure cited from Front Neurol, PMID: 29250027

• 

  Coomassie blue staining of purified NRGN protein (Cat# TP301209). The protein was produced from HEK293T cells transfected with NRGN cDNA clone (Cat# RC201209) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201209 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGG
  AGGGPSGD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: ELISA standard (PMID: 29250027)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006167
• Locus ID: 4900
• UniProt ID: Q92686, A0A024R3M7
• Cytogenetics: 11q24.2
• Refseq Size: 1235
• Refseq ORF: 234
• Synonyms: hng; RC3
• Summary: Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome