Neurogranin (NRGN) (NM_001126181) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC224996] |
Predicted MW | 7.6 kDa |
Protein Sequence |
Protein Sequence
>RC224996 protein sequence
Red=Cloning site Green=Tags(s) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGG AGGGPSGD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001119653 |
RefSeq Size | 1238 |
RefSeq ORF | 234 |
Synonyms | hng; RC3 |
Locus ID | 4900 |
UniProt ID | Q92686 |
Cytogenetics | 11q24.2 |
Summary | Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301209 | NRGN MS Standard C13 and N15-labeled recombinant protein (NP_006167) | 10 ug |
$3,255.00
|
|
LC416815 | NRGN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426667 | NRGN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY416815 | Transient overexpression lysate of neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1 | 100 ug |
$436.00
|
|
LY426667 | Transient overexpression lysate of neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 2 | 100 ug |
$436.00
|
|
TP301209 | Recombinant protein of human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP324996 | Recombinant protein of human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.