CCDC106 (NM_013301) Human Recombinant Protein

CAT#: TP301207

Recombinant protein of human coiled-coil domain containing 106 (CCDC106), 20 µg

Product Images

Coomassie blue staining of purified CCDC106 protein (Cat# TP301207). The protein was produced from HEK293T cells transfected with CCDC106 cDNA clone (Cat# RC201207) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201207 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNDRSSRRRTMKDDETFEISIPFDEAPHLDPQIFYSLSPSRRNFEEPPEAASSALALMNSVKTQLHMALE
  RNSWLQKRIEDLEEERDFLRCQLDKFISSARMEAEDHCRMKPGPRRMEGDSRGGAGGEASDPESAASSLS
  GASEEGSASERRRQKQKGGASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDR
  NTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_037433
• Locus ID: 29903
• UniProt ID: Q9BWC9
• Cytogenetics: 19q13.42
• Refseq Size: 1993
• Refseq ORF: 840
• Synonyms: HSU79303; ZNF581
• Summary: Promotes the degradation of p53/TP53 protein and inhibits its transactivity.[UniProtKB/Swiss-Prot Function]