OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC106 (NM_013301) Human Mass Spec Standard

Be the first to review this product
SKU
PH301207
CCDC106 MS Standard C13 and N15-labeled recombinant protein (NP_037433)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349754 Rabbit Polyclonal Anti-CCDC106 Antibody
100 ul
$205.00
LY415675 Transient overexpression lysate of coiled-coil domain containing 106 (CCDC106) (as WB positive control) 100 ug
$436.00

Other products for "CCDC106 or NM_013301"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201207
Predicted MW 32 kDa
Protein Sequence
Protein Sequence
>RC201207 protein sequence
Red=Cloning site Green=Tags(s)

MNDRSSRRRTMKDDETFEISIPFDEAPHLDPQIFYSLSPSRRNFEEPPEAASSALALMNSVKTQLHMALE
RNSWLQKRIEDLEEERDFLRCQLDKFISSARMEAEDHCRMKPGPRRMEGDSRGGAGGEASDPESAASSLS
GASEEGSASERRRQKQKGGASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDR
NTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037433
RefSeq Size 1993
RefSeq ORF 840
Synonyms HSU79303; ZNF581
Locus ID 29903
UniProt ID Q9BWC9
Cytogenetics 19q13.42
Summary Promotes the degradation of p53/TP53 protein and inhibits its transactivity.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC106" proteins (3)
SKU Description Size Price
LC415675 Lyophilized CCDC106 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415675 Transient overexpression lysate of coiled-coil domain containing 106 (CCDC106) (as WB positive control) 100 ug
$436.00
TP301207 Recombinant protein of human coiled-coil domain containing 106 (CCDC106), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products