OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PPIC (NM_000943) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301143
Recombinant protein of human peptidylprolyl isomerase C (cyclophilin C) (PPIC), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA366422 PPIC rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PPIC or NM_000943"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201143 protein sequence
Red=Cloning site Green=Tags(s)

MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENF
VALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPD
TNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIA
DW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000934
Locus ID 5480
UniProt ID P45877
Cytogenetics 5q23.2
RefSeq Size 1241
RefSeq ORF 636
Synonyms CYPC
Summary The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase)) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. Similar to other PPIases, this protein can bind immunosuppressant cyclosporin A. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PPIC" proteins (4)
SKU Description Size Price
PH301143 PPIC MS Standard C13 and N15-labeled recombinant protein (NP_000934) 10 ug
$3,360.00
LC424438 Lyophilized PPIC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424438 Transient overexpression lysate of peptidylprolyl isomerase C (cyclophilin C) (PPIC) (as WB positive control) 100 ug
$436.00
TP720190 Recombinant protein of human peptidylprolyl isomerase C (cyclophilin C) (PPIC) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products