TPM4 (NM_003290) Human Recombinant Protein

CAT#: TP301133

Recombinant protein of human tropomyosin 4 (TPM4), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified TPM4 protein (Cat# TP301133). The protein was produced from HEK293T cells transfected with TPM4 cDNA clone (Cat# RC201133) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201133 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLFEEELDRAQERL
  ATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGEL
  ERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTV
  AKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003281
• Locus ID: 7171
• UniProt ID: P67936, V9HW56
• Cytogenetics: 19p13.12-p13.11
• Refseq Size: 2645
• Refseq ORF: 744
• Synonyms: HEL-S-108
• Summary: This gene encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosins are dimers of coiled-coil proteins that polymerize end-to-end along the major groove in most actin filaments. They provide stability to the filaments and regulate access of other actin-binding proteins. In muscle cells, they regulate muscle contraction by controlling the binding of myosin heads to the actin filament. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2009]
• Protein Pathways: Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)