OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TPM4 (NM_003290) Human Mass Spec Standard

Be the first to review this product
SKU
PH301133
TPM4 MS Standard C13 and N15-labeled recombinant protein (NP_003281)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY428735 Transient overexpression lysate of tropomyosin 4 (TPM4), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TPM4 or NM_003290"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201133
Predicted MW 28.6 kDa
Protein Sequence
Protein Sequence
>RC201133 protein sequence
Red=Cloning site Green=Tags(s)

MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLFEEELDRAQERL
ATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGEL
ERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTV
AKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003281
RefSeq Size 2645
RefSeq ORF 744
Synonyms HEL-S-108
Locus ID 7171
UniProt ID P67936
Cytogenetics 19p13.12-p13.11
Summary This gene encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosins are dimers of coiled-coil proteins that polymerize end-to-end along the major groove in most actin filaments. They provide stability to the filaments and regulate access of other actin-binding proteins. In muscle cells, they regulate muscle contraction by controlling the binding of myosin heads to the actin filament. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Nov 2009
Protein Pathways Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TPM4" proteins (7)
SKU Description Size Price
PH327534 TPM4 MS Standard C13 and N15-labeled recombinant protein (NP_001138632) 10 ug
$3,360.00
LC418787 Lyophilized TPM4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428735 Lyophilized TPM4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418787 Transient overexpression lysate of tropomyosin 4 (TPM4), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428735 Transient overexpression lysate of tropomyosin 4 (TPM4), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301133 Recombinant protein of human tropomyosin 4 (TPM4), transcript variant 2, 20 µg 20 ug
$737.00
TP327534 Purified recombinant protein of Homo sapiens tropomyosin 4 (TPM4), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products