OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MYL9 (NM_181526) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301080
Recombinant protein of human myosin, light chain 9, regulatory (MYL9), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA813394 MYL9 mouse monoclonal antibody,clone OTI3H6 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MYL9 or NM_181526"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201080 protein sequence
Red=Cloning site Green=Tags(s)

MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGFIHEDHLR
ELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 13.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_852667
Locus ID 10398
UniProt ID P24844
Cytogenetics 20q11.23
RefSeq Size 1054
RefSeq ORF 354
Synonyms LC20; MLC-2C; MLC2; MMIHS4; MRLC1; MYRL2
Summary Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Pathways Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction, Vascular smooth muscle contraction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MYL9" proteins (5)
SKU Description Size Price
PH301080 MYL9 MS Standard C13 and N15-labeled recombinant protein (NP_852667) 10 ug
$3,360.00
LC405690 Lyophilized MYL9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416863 Lyophilized MYL9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405690 Transient overexpression lysate of myosin, light chain 9, regulatory (MYL9), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY416863 Transient overexpression lysate of myosin, light chain 9, regulatory (MYL9), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products