OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ATG101 (NM_021934) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301011
Recombinant protein of human chromosome 12 open reading frame 44 (C12orf44), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA319995 Rabbit Polyclonal ATG101 Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ATG101 or NM_021934"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201011 protein sequence
Red=Cloning site Green=Tags(s)

MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSE
ELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQIC
REKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRR
LIKDTLAL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_068753
Locus ID 60673
UniProt ID Q9BSB4
Cytogenetics 12q13.13
RefSeq Size 1458
RefSeq ORF 654
Synonyms C12orf44
Summary Autophagy factor required for autophagosome formation. Stabilizes ATG13, protecting it from proteasomal degradation.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ATG101" proteins (6)
SKU Description Size Price
PH301011 C12orf44 MS Standard C13 and N15-labeled recombinant protein (NP_068753) 10 ug
$3,360.00
LC411867 Lyophilized ATG101 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420665 Lyophilized ATG101 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411867 Transient overexpression lysate of chromosome 12 open reading frame 44 (C12orf44), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420665 Transient overexpression lysate of chromosome 12 open reading frame 44 (C12orf44), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP760632 Purified recombinant protein of Human chromosome 12 open reading frame 44 (C12orf44), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products