OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ATG101 (NM_021934) Human Mass Spec Standard

Be the first to review this product
SKU
PH301011
C12orf44 MS Standard C13 and N15-labeled recombinant protein (NP_068753)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA319995 Rabbit Polyclonal ATG101 Antibody
100 ug
$640.00
LY411867 Transient overexpression lysate of chromosome 12 open reading frame 44 (C12orf44), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ATG101 or NM_021934"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201011
Predicted MW 25 kDa
Protein Sequence
Protein Sequence
>RC201011 protein sequence
Red=Cloning site Green=Tags(s)

MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSE
ELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQIC
REKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRR
LIKDTLAL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068753
RefSeq Size 1458
RefSeq ORF 654
Synonyms C12orf44
Locus ID 60673
UniProt ID Q9BSB4
Cytogenetics 12q13.13
Summary Autophagy factor required for autophagosome formation. Stabilizes ATG13, protecting it from proteasomal degradation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ATG101" proteins (6)
SKU Description Size Price
LC411867 Lyophilized ATG101 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420665 Lyophilized ATG101 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411867 Transient overexpression lysate of chromosome 12 open reading frame 44 (C12orf44), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420665 Transient overexpression lysate of chromosome 12 open reading frame 44 (C12orf44), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301011 Recombinant protein of human chromosome 12 open reading frame 44 (C12orf44), transcript variant 1, 20 µg 20 ug
$867.00
TP760632 Purified recombinant protein of Human chromosome 12 open reading frame 44 (C12orf44), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products