OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AKIRIN2 (NM_018064) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300881
Recombinant protein of human akirin 2 (AKIRIN2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA306646 Rabbit Polyclonal Akirin2 Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "AKIRIN2 or NM_018064"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200881 protein sequence
Red=Cloning site Green=Tags(s)

MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFG
DVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQ
PLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060534
Locus ID 55122
UniProt ID Q53H80
Cytogenetics 6q15
RefSeq Size 1948
RefSeq ORF 609
Synonyms C6orf166; dJ486L4.2; FBI1
Summary Required for the innate immune response. Downstream effector of the Toll-like receptor (TLR), TNF and IL-1 beta signaling pathways leading to the production of IL-6. Forms a complex with YWHAB that acts to repress transcription of DUSP1 (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AKIRIN2" proteins (3)
SKU Description Size Price
PH300881 AKIRIN2 MS Standard C13 and N15-labeled recombinant protein (NP_060534) 10 ug
$3,360.00
LC413339 Lyophilized AKIRIN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413339 Transient overexpression lysate of akirin 2 (AKIRIN2) (as WB positive control) 100 ug
$436.00

file-alt Citations

Function of cofactor Akirin2 in the regulation of gene expression in model human Caucasian neutrophil-like HL60 cells
Artigas-Jerónimo, Villar, Estrada-Peña et al
Biosci Rep (2021) 41 (7) DOI: 10.1042/BSR20211120
AI Summary: In this study, OriGene's human recombinant Akirin2 protein (TP300881) produced in HEK293T cells was used to investigate the regulatory functions and protein interactions of Akirin2 in HL60 cells.
Snippet: Human recombinant Akirin2 (recAkirin2;Q53H80) produced in Escherichia coli (GenScript, Piscataway, NJ, USA) or in human kidney HEK293T cells (TP300881;OriGene, Rockville, MD, USA) was COOH-(Myc-(EQKLISEEDL)-DDK)-tagged and was used for the
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products