AKIRIN2 (NM_018064) Human Recombinant Protein

CAT#: TP300881

Recombinant protein of human akirin 2 (AKIRIN2), 20 µg

Product Images

Coomassie blue staining of purified AKIRIN2 protein (Cat# TP300881). The protein was produced from HEK293T cells transfected with AKIRIN2 cDNA clone (Cat# RC200881) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200881 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFG
  DVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQ
  PLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060534
• Locus ID: 55122
• UniProt ID: Q53H80, Q9NW35
• Cytogenetics: 6q15
• Refseq Size: 1948
• Refseq ORF: 609
• Synonyms: C6orf166; dJ486L4.2; FBI1
• Summary: Required for the innate immune response. Downstream effector of the Toll-like receptor (TLR), TNF and IL-1 beta signaling pathways leading to the production of IL-6. Forms a complex with YWHAB that acts to repress transcription of DUSP1 (By similarity).[UniProtKB/Swiss-Prot Function]