HYPK (NM_016400) Human Recombinant Protein

CAT#: TP300840

Recombinant protein of human Huntingtin interacting protein K (HYPK), 20 µg

Product Images

Coomassie blue staining of purified HYPK protein (Cat# TP300840). The protein was produced from HEK293T cells transfected with HYPK cDNA clone (Cat# RC200840) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200840 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRRRGEIDMATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIGDR
  RSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIALTN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057484
• Locus ID: 25764
• UniProt ID: Q9NX55, A0A024R5Q1
• Cytogenetics: 15q15.3
• Refseq Size: 1351
• Refseq ORF: 387
• Synonyms: C15orf63; HSPC136
• Summary: Has a chaperone-like activity preventing polyglutamine (polyQ) aggregation of HTT. Protects against HTT polyQ-mediated apoptosis in Neuro2a neuronal cells. Required for optimal NAA10-NAA15 complex-mediated N-terminal acetylation.[UniProtKB/Swiss-Prot Function]