HYPK (NM_016400) Human Recombinant Protein
CAT#: TP300840
Recombinant protein of human Huntingtin interacting protein K (HYPK), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200840 protein sequence
Red=Cloning site Green=Tags(s) MRRRGEIDMATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIGDR RSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIALTN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057484 |
Locus ID | 25764 |
UniProt ID | Q9NX55, A0A024R5Q1 |
Cytogenetics | 15q15.3 |
Refseq Size | 1351 |
Refseq ORF | 387 |
Synonyms | C15orf63; HSPC136 |
Summary | Has a chaperone-like activity preventing polyglutamine (polyQ) aggregation of HTT. Protects against HTT polyQ-mediated apoptosis in Neuro2a neuronal cells. Required for optimal NAA10-NAA15 complex-mediated N-terminal acetylation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413998 | HYPK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413998 | Transient overexpression lysate of chromosome 15 open reading frame 63 (C15orf63) |
USD 436.00 |
|
PH300840 | C15orf63 MS Standard C13 and N15-labeled recombinant protein (NP_057484) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review