PECR (NM_018441) Human Recombinant Protein

CAT#: TP300822

Recombinant protein of human peroxisomal trans-2-enoyl-CoA reductase (PECR)

Product Images

Coomassie blue staining of purified PECR protein (Cat# TP300822). The protein was produced from HEK293T cells transfected with PECR cDNA clone (Cat# RC200822) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200822 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTK
  QARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCK
  AVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAV
  ENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNW
  PKGAGDLSVVKKMKETFKEKAKL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Applications: Cell culture: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060911
• Locus ID: 55825
• UniProt ID: Q9BY49
• Cytogenetics: 2q35
• Refseq Size: 1874
• Refseq ORF: 909
• Synonyms: DCRRP; HPDHASE; HSA250303; PVIARL; SDR29C1; TERP
• Summary: Participates in chain elongation of fatty acids. Has no 2,4-dienoyl-CoA reductase activity.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Biosynthesis of unsaturated fatty acids