OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

beta III Tubulin (TUBB3) (NM_006086) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300755
Recombinant protein of human tubulin, beta 3 (TUBB3), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA500047 TUBB3 (beta III Tubulin) mouse monoclonal antibody, clone OTI5H2 (formerly 5H2) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "beta III Tubulin or NM_006086"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200755 protein sequence
Red=Cloning site Green=Tags(s)

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEP
GTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLG
GGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDI
CFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQ
YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVK
VAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEMYEDDEEESEAQGPK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Co-immunoprecipitation (PMID: 25754961)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006077
Locus ID 10381
UniProt ID Q13509
Cytogenetics 16q24.3
RefSeq Size 1794
RefSeq ORF 1350
Synonyms beta-4; CDCBM; CDCBM1; CFEOM3; CFEOM3A; FEOM3; TUBB4
Summary This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6. provided by RefSeq, Oct 2010
Protein Categories Cytokines, Intracellular Proteins, Nervous system Diseases
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Protein Pathways Gap junction, Pathogenic Escherichia coli infection
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "beta III Tubulin" proteins (3)
SKU Description Size Price
PH300755 TUBB3 MS Standard C13 and N15-labeled recombinant protein (NP_006077) 10 ug
$3,360.00
LC416872 Lyophilized TUBB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416872 Transient overexpression lysate of tubulin, beta 3 (TUBB3) (as WB positive control) 100 ug
$436.00

file-alt Citations

Coordinated interaction of Down syndrome cell adhesion molecule and deleted in colorectal cancer with dynamic TUBB3 mediates Netrin-1-induced axon branching
Huang, Shao, Qu et al
Neuroscience (2015) 293, 109-22 DOI: 10.1016/j.neuroscience.2015.02.042
Cited by 28
AI Summary: OriGene contributed purified TUBB3 protein, which was used to study its interactions with DSCAM and DCC in Netrin-1-induced axon branching.
Snippet: USA). Eluted protein purity was analyzed by sodium dodecyl sulfate–polyacrylamide gel electrophoresis (SDS–PAGE), followed by Coomassie Blue staining. Purified TUBB3 was from Origene (Rockville, MD, USA). Netrin-1 ... Cite SaveSaving
Direct binding of TUBB3 with DCC couples netrin-1 signaling to intracellular microtubule dynamics in axon outgrowth and guidance
Qu, Dwyer, Shao et al
J. Cell. Sci. (2013) 126 (Pt 14), 3070-81 DOI: 10.1242/jcs.122184
Cited by 59
AI Summary: OriGene contributed purified TUBB3 protein to this study, which was used to investigate the direct interaction between TUBB3 and DCC in netrin-1 signaling and microtubule dynamics during axon outgrowth and guidance.
Snippet: OH, USA). PP2 and PP3 were from Calbiochem. Purified TUBB3 was purchased from Origene (Rockville, MD, USA) and TUBB3- GST from Abnova (Walnut, CA, USA). Plasmids encoding TUBB3, DCC, DCC-ΔP1 (Δ1147- 1170
The Coordination of Netrin Signal Transduction via TUBB3 and JNK1 in Axon
Qu
Thesis (2013)
Snippet: Other Page 30. 17 purchased reagents: Purified TUBB3-GST protein (Abnova), purified TUBB3 protein (Origene), PP2 and PP3 (Calbiochem), Taxol and Nocadazole (MP biochemicals) 3.3 Immunoprecipitation and western blot analysis ... Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products