OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

beta III Tubulin (TUBB3) (NM_006086) Human Mass Spec Standard

Be the first to review this product
SKU
PH300755
TUBB3 MS Standard C13 and N15-labeled recombinant protein (NP_006077)
Size:
10 ug
  $3,360.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA500047 TUBB3 (beta III Tubulin) mouse monoclonal antibody, clone OTI5H2 (formerly 5H2) 100 ul
$447.00
LY416872 Transient overexpression lysate of tubulin, beta 3 (TUBB3) (as WB positive control) 100 ug
$436.00

Other products for "beta III Tubulin or NM_006086"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200755
Predicted MW 50.4 kDa
Protein Sequence
Protein Sequence
>RC200755 protein sequence
Red=Cloning site Green=Tags(s)

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEP
GTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLG
GGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDI
CFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQ
YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVK
VAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEMYEDDEEESEAQGPK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006077
RefSeq Size 1794
RefSeq ORF 1350
Synonyms beta-4; CDCBM; CDCBM1; CFEOM3; CFEOM3A; FEOM3; TUBB4
Locus ID 10381
UniProt ID Q13509
Cytogenetics 16q24.3
Summary This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6. provided by RefSeq, Oct 2010
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Protein Pathways Gap junction, Pathogenic Escherichia coli infection
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "beta III Tubulin" proteins (3)
SKU Description Size Price
LC416872 Lyophilized TUBB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416872 Transient overexpression lysate of tubulin, beta 3 (TUBB3) (as WB positive control) 100 ug
$436.00
TP300755 Recombinant protein of human tubulin, beta 3 (TUBB3), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products