OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ALDH1A1 (NM_000689) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300723
Recombinant protein of human aldehyde dehydrogenase 1 family, member A1 (ALDH1A1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA302024 ALDH1A1 Antibody (Center)
400 ul
$645.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ALDH1A1 or NM_000689"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200723 representing NM_000689
Red=Cloning site Green=Tags(s)

MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQA
FQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKI
QGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIK
EAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLA
DADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
YDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVK
TVTVKISQKNS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 95% as determined by SDS-PAGE and Coomassie blue staining
Buffer >200 ug/mL as determined by Microplate Bradford Protein Assay method
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000680
Locus ID 216
UniProt ID P00352
Cytogenetics 9q21.13
RefSeq Size 2116
RefSeq ORF 1503
Synonyms ALDC; ALDH-E1; ALDH1; ALDH11; HEL-9; HEL-S-53e; HEL12; PUMB1; RALDH1
Summary The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet. provided by RefSeq, Mar 2011
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Protein Pathways Metabolic pathways, Retinol metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ALDH1A1" proteins (4)
SKU Description Size Price
PH300723 ALDH1A1 MS Standard C13 and N15-labeled recombinant protein (NP_000680) 10 ug
$3,360.00
LC400230 Lyophilized ALDH1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400230 Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A1 (ALDH1A1) (as WB positive control) 100 ug
$436.00
TP720901 Purified recombinant protein of Human aldehyde dehydrogenase 1 family, member A1 (ALDH1A1) 10 ug
$260.00

file-alt Citations

Stemness marker ALDH1A1 promotes tumor angiogenesis via retinoic acid/HIF-1α/VEGF signalling in MCF-7 breast cancer cells
Ciccone, Terzuoli, Donnini et al
J. Exp. Clin. Cancer Res. (2018) 37 (1), 311 DOI: 10.1186/s13046-018-0975-0
AI Summary: OriGene contributed lentiviral particles to this study, which were used to manipulate ALDH1A1 expression levels in MCF-7 breast cancer cells to investigate its role in tumor angiogenesis.
Snippet: Louis, MO, USA). CelLytic MT Cell Lysis Reagent, Fluoromount Aqueous Mounting Medium, 3 kDa FITC-Dextran were from Life Technologies (Carlsbad, CA, USA). Lentiviral particles were from OriGene (Rockville, MD, USA) Cached;CelLytic MT Cell Lysis Reagent, Fluoromount Aqueous Mounting Medium, 3 kDa FITC-Dextran were from Life Technologies (Carlsbad, CA, USA). Lentiviral particles were from Or...
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products