OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PAN2 (NM_014871) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300573
Recombinant protein of human PAN2 poly(A) specific ribonuclease subunit homolog (S. cerevisiae) (PAN2), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PAN2 or NM_014871"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200573 protein sequence
Red=Cloning site Green=Tags(s)

MNFEGLDPGLAEYAPAMHSALDPVLDAHLNPNLLQNVELDPEGVALEALPVQESVHIMEGVYSELHSVVA
EVGVPVSVSHFDLHEEMLWVGSHGGHATSFFGPALERYSSFQVNGSDDIRQIQSLENGILFLTKNNLKYM
ARGGLIIFDYLLDENEDMHSLLLTDSSTLLVGGLQNHILEIDLNTVQETQKYAVETPGVTIMRQTNRFFF
CGHTSGKVSLRDLRTFKVEHEFDAFSGSLSDFDVHGNLLAACGFSSRLTGLACDRFLKVYDLRMMRAITP
LQVHVDPAFLRFIPTYTSRLAIISQSGQCQFCEPTGLANPADIFHVNPVGPLLMTFDVSASKQALAFGDS
EGCVHLWTDSPEPSFNPYSRETEFALPCLVDSLPPLDWSQDLLPLSLIPVPLTTDTLLSDWPAANSAPAP
RRAPPVDAEILRTMKKVGFIGYAPNPRTRLRNQIPYRLKESDSEFDSFSQVTESPVGREEEPHLHMVSKK
YRKVTIKYSKLGLEDFDFKHYNKTLFAGLEPHIPNAYCNCMIQVLYFLEPVRCLIQNHLCQKEFCLACEL
GFLFHMLDLSRGDPCQGNNFLRAFRTIPEASALGLILADSDEASGKGNLARLIQRWNRFILTQLHQDMQE
LEIPQAYRGAGGSSFCSSGDSVIGQLFSCEMENCSLCRCGSETVRASSTLLFTLSYPDDKTGKNYDFAQV
LKRSICLDQNTQAWCDTCEKYQPTIQTRNIRHLPDILVINCEVNSSKEADFWRMQAEVAFKMAVKKHGGE
ISKNKEFALADWKELGSPEGVLVCPSIEELKNVWLPFSIRMKMTKNKGLDVCNWTDGDEMQWGPARAEEE
HGVYVYDLMATVVHILDSRTGGSLVAHIKVGETYHQRKEGVTHQQWYLFNDFLIEPIDKHEAVQFDMNWK
VPAILYYVKRNLNSRYNLNIKNPIEASVLLAEASLARKQRKTHTTFIPLMLNEMPQIGDLVGLDAEFVTL
NEEEAELRSDGTKSTIKPSQMSVARITCVRGQGPNEGIPFIDDYISTQEQVVDYLTQYSGIKPGDLDAKI
SSKHLTTLKSTYLKLRFLIDIGVKFVGHGLQKDFRVINLMVPKDQVLDTVYLFHMPRKRMISLRFLAWYF
LDLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAA
VFSSVLAL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 134.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055686
Locus ID 9924
UniProt ID Q504Q3
Cytogenetics 12q13.3
RefSeq Size 5289
RefSeq ORF 3594
Synonyms USP52
Summary This gene encodes a deadenylase that functions as the catalytic subunit of the polyadenylate binding protein dependent poly(A) nuclease complex. The encoded protein is a magnesium dependent 3' to 5' exoribonuclease that is involved in the degradation of cytoplasmic mRNAs. Alternate splicing results in multiple transcript variants. provided by RefSeq, Oct 2009
Protein Categories Enzyme: Peptidases, Intracellular Proteins
Protein Families Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PAN2" proteins (5)
SKU Description Size Price
PH300573 PAN2 MS Standard C13 and N15-labeled recombinant protein (NP_055686) 10 ug
$3,360.00
LC402390 Lyophilized PAN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426794 Lyophilized PAN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402390 Transient overexpression lysate of PAN2 poly(A) specific ribonuclease subunit homolog (S. cerevisiae) (PAN2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY426794 Transient overexpression lysate of PAN2 poly(A) specific ribonuclease subunit homolog (S. cerevisiae) (PAN2), transcript variant 1 (as WB positive control) 100 ug
$665.00

file-alt Citations

A feedback mechanism between PLD and deadenylase PARN for the shortening of eukaryotic poly(A) mRNA tails that is deregulated in cancer cells
Miller, Gomez-Cambronero
Biol Open (2017) 6 (2), 176-186 DOI: 10.1242/bio.021261
AI Summary: In this study, the OriGene pCMV6-myc-DDK-PARN-WT plasmid (RC207220) was used as the source for PARN overexpression and mutagenesis, enabling the authors to investigate the regulatory interplay between PARN and PLD2 in mRNA decay and cancer cell signaling.
Snippet: Plasmid DNAs used herein were as follows: pcDNA3.1-myc-PLD2-WT and pcDNA3.10-myc-PLD2-K758R were previously designed in our lab, pCMV6-myc-DDK-PARN-WT was from Origene (RC207220, Rockville, MD) and this plasmid was the basis for site-directed mutagenesis to generate PARN-H377A
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products