OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FOXO1 (NM_002015) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300477
Recombinant protein of human forkhead box O1 (FOXO1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FOXO1 or NM_002015"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200477 representing NM_002015
Red=Cloning site Green=Tags(s)

MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADF
MSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPA
AAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWK
NSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSG
QEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPP
SAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN
YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSR
VLGQNVMMGPNSVMSTYGSQVSHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKT
PVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDF
NFDNVLPNQSFPHSVKTTTHSWVSG

LEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 69.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity In vitro kinase assay substrate (PMID: 29066835)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002006
Locus ID 2308
UniProt ID Q12778
Cytogenetics 13q14.11
RefSeq Size 5723
RefSeq ORF 1965
Synonyms FKH1; FKHR; FOXO1A
Summary This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. provided by RefSeq, Jul 2008
Protein Categories Cancer: Haematopoietic and Lymphoid, Cancer: Sarcoma, Growth Factors, Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Insulin signaling pathway, Pathways in cancer, Prostate cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FOXO1" proteins (3)
SKU Description Size Price
PH300477 FOXO1 MS Standard C13 and N15-labeled recombinant protein (NP_002006) 10 ug
$3,360.00
LC419586 Lyophilized FOXO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419586 Transient overexpression lysate of forkhead box O1 (FOXO1) (as WB positive control) 100 ug
$436.00

file-alt Citations

The HDAC3-SMARCA4-miR-27a axis promotes expression of the PAX3:FOXO1 fusion oncogene in rhabdomyosarcoma
Bharathy, Berlow, Wang et al
Sci Signal (2018) 11 (557) DOI: 10.1126/scisignal.aau7632
AI Summary: OriGene's recombinant FOXO1 (NM_002015) protein was used as a control to analyze endogenous wild-type FOXO1 expression in this study.
Snippet: antibody (1:10,000;Abcam, catalog no. ab8227). All blots were visualized using a FluorChem Q system (ProteinSimple). To analyze endogenous wild-type FOXO1 expression, recombinant FOXO1 (NM_002015) (Origene) was used. FOXO3 (NM_001455) was used as negative control to choose the appropriate antibody (fig. S7). Anti-FOXO1 antibody (1:500;Millipore, clone 2H8.2) detects recombinant FOXO1 without ba
Cellular hormetic response to 27-hydroxycholesterol promotes neuroprotection through AICD induction of MAST4 abundance and kinase activity
Gongol, Marin, Jeppson et al
Sci Rep (2017) 7 (1), 13898 DOI: 10.1038/s41598-017-13933-9
AI Summary: OriGene’s human recombinant FOXO1 protein (catalog #TP300477) was used in kinase assays to investigate the phosphorylation and regulation of FOXO1 within the neuroprotective signaling pathway described in the study.
Snippet: Article.;... buffer. (50 mM Tris, pH 7.4, 10 mM MgCl2) supplemented with 50 µM ATP and human recombinant FOXO1 (1 µg;Origene #TP300477). Kinase reactions were run on 4-20% Tris-Glycine polyacrylamide gels (Thermofisher) and. ...;Origene #TP300477). Kinase reactions were run on 4-20% Tris-Glycine polyacrylamide gels (Thermofisher) and.
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products