Neuraminidase (NEU1) (NM_000434) Human Recombinant Protein

CAT#: TP300386

Recombinant protein of human sialidase 1 (lysosomal sialidase) (NEU1), 20 µg

Product Images

NEU2 and NEU3 upregulate TGF-beta1 by PBMC. Human PBMC were incubated with or without recombinant human sialidases, NEU1 (OriGene TP300386), NEU2 (OriGene TP319858), NEU3 (OriGene TP316537), NEU4 (OriGene TP303948) for five days, then air-dried and stained for TGF-beta1. Positive staining appears pink, and counterstaining is blue. Bar is 0.1 mm. Figure cited from Sci Rep, PMID: 29118338

• 

  Coomassie blue staining of purified NEU1 protein (Cat# TP300386). The protein was produced from HEK293T cells transfected with NEU1 cDNA clone (Cat# RC200386) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200386 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTMEQLLWVSGRQ
  IGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLG
  AVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREP
  RKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINAR
  NQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSF
  SNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 40.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Cell treatment (PMID: 29118338)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000425
• Locus ID: 4758
• UniProt ID: Q99519, Q5JQI0
• Cytogenetics: 6p21.33
• Refseq Size: 2088
• Refseq ORF: 1245
• Synonyms: NANH; NEU; SIAL1
• Summary: The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter is also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis, a lysosomal storage disease that can be type 1 (cherry red spot-myoclonus syndrome or normosomatic type), which is late-onset, or type 2 (the dysmorphic type), which occurs at an earlier age with increased severity. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Lysosome, Other glycan degradation, Sphingolipid metabolism