Neuraminidase (NEU1) (NM_000434) Human Mass Spec Standard

SKU
PH300386
NEU1 MS Standard C13 and N15-labeled recombinant protein (NP_000425)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200386]
Predicted MW 45.5 kDa
Protein Sequence
Protein Sequence
>RC200386 protein sequence
Red=Cloning site Green=Tags(s)

MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTMEQLLWVSGRQ
IGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLG
AVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREP
RKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINAR
NQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSF
SNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000425
RefSeq Size 2088
RefSeq ORF 1245
Synonyms NANH; NEU; SIAL1
Locus ID 4758
UniProt ID Q99519
Cytogenetics 6p21.33
Summary The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter is also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis, a lysosomal storage disease that can be type 1 (cherry red spot-myoclonus syndrome or normosomatic type), which is late-onset, or type 2 (the dysmorphic type), which occurs at an earlier age with increased severity. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Lysosome, Other glycan degradation, Sphingolipid metabolism
Write Your Own Review
You're reviewing:Neuraminidase (NEU1) (NM_000434) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424720 NEU1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424720 Transient overexpression lysate of sialidase 1 (lysosomal sialidase) (NEU1) 100 ug
$436.00
TP300386 Recombinant protein of human sialidase 1 (lysosomal sialidase) (NEU1), 20 µg 20 ug
$737.00
TP721041 Purified recombinant protein of Human sialidase 1 (lysosomal sialidase) (NEU1) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.