Cytochrome C Oxidase subunit VIc (COX6C) (NM_004374) Human Recombinant Protein

CAT#: TP300374

Reviews ()
Write a review

Recombinant protein of human cytochrome c oxidase subunit VIc (COX6C)



  View other "COX6C" proteins (3)

USD 867.00


Availability*
In Stock

Size
    • 20 ug


Product images

Other products for "COX6C"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC200374 protein sequence
Red=Cloning site Green=Tags(s)

MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGI
FQSVK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 8.6 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_004365
Locus ID 1345
UniProt ID P09669, A0A024R9B7
Cytogenetics 8q22.2
Refseq Size 921
Refseq ORF 225
Synonyms cytochrome c oxidase subunit VIc; cytochrome c oxidase subunit VIc preprotein
Summary Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene has been found on chromosomes 16p12. [provided by RefSeq, Jul 2010]
Protein Families Transmembrane
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease

Documents

Other Versions

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00


COX6C mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)
    • 100 ul

USD 447.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.