OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cytochrome C Oxidase subunit VIc (COX6C) (NM_004374) Human Mass Spec Standard

Be the first to review this product
SKU
PH300374
COX6C MS Standard C13 and N15-labeled recombinant protein (NP_004365)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA506179 COX6C mouse monoclonal antibody, clone OTI4B11 (formerly 4B11) 100 ul
$447.00
LY418028 Transient overexpression lysate of cytochrome c oxidase subunit VIc (COX6C) (as WB positive control) 100 ug
$436.00

Other products for "Cytochrome C Oxidase subunit VIc or NM_004374"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200374
Predicted MW 8.8 kDa
Protein Sequence
Protein Sequence
>RC200374 protein sequence
Red=Cloning site Green=Tags(s)

MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGI
FQSVK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004365
RefSeq Size 921
RefSeq ORF 225
Locus ID 1345
UniProt ID P09669
Cytogenetics 8q22.2
Summary Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene has been found on chromosomes 16p12. provided by RefSeq, Jul 2010
Protein Families Transmembrane
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Cytochrome C Oxidase subunit VIc" proteins (3)
SKU Description Size Price
LC418028 Lyophilized COX6C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418028 Transient overexpression lysate of cytochrome c oxidase subunit VIc (COX6C) (as WB positive control) 100 ug
$436.00
TP300374 Recombinant protein of human cytochrome c oxidase subunit VIc (COX6C), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products