OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Syntaxin 4 (STX4) (NM_004604) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300347M
Recombinant protein of human syntaxin 4 (STX4), 100 µg
Size:
100 ug 20 ug 1 mg
  $2,508.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308255 Rabbit polyclonal antibody to Syntaxin 4 (syntaxin 4)
100 ul
$665.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Syntaxin 4 or NM_004604"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200347 protein sequence
Red=Cloning site Green=Tags(s)

MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTIL
ATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINK
CNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEI
QQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV
SITVVLLAVIIGVTVVG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004595
Locus ID 6810
UniProt ID Q12846
Cytogenetics 16p11.2
RefSeq Size 1494
RefSeq ORF 891
Synonyms p35-2; STX4A
Summary Plasma membrane t-SNARE that mediates docking of transport vesicles. Necessary for the translocation of SLC2A4 from intracellular vesicles to the plasma membrane. Together with STXB3 and VAMP2, may also play a role in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes (By similarity). May also play a role in docking of synaptic vesicles at presynaptic active zones.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Development and Validation of Diagnostic Models for Transcriptomic Signature Genes for Multiple Tissues in Osteoarthritis
Gao, Ma, Shao et al
JIR (2024) Volume 17, 5113-5127 DOI: 10.2147/JIR.S472118
AI Summary: OriGene's DAB (ZLI-9018) was utilized in this study for chromogenic detection during immunohistochemical analysis to visualize transcriptomic signature genes in multiple tissues affected by osteoarthritis.
Snippet: ections were subsequently blocked with goat serum (AR1009;Boster). Primary and secondary antibodies were then incubated sequentially. DAB (ZLI-9018, Origene) was used for chromogenic detection, and hematoxylin (G1004, Servicebio) was used for nuclear staining
SKA2 regulated hyperactive secretory autophagy drives neuroinflammation-induced neurodegeneration
Hartmann, Bajaj, Otten et al
Nat Commun (2024) 15 (1), 2635 DOI: 10.1038/s41467-024-46953-x
Cited by 33
AI Summary: OriGene products—specifically Syntaxin3-DDK (TP300658), SNAP29-DDK (TP302179), Syntaxin4 (TP300347), SNAP23-DDK (TP301596), and SEC22B-HIS (AR50533PU-S)—were used as purified recombinant proteins in binding assays to investigate the molecular mechanisms underlying secretory autophagy in neuroinflammation-mediated neurodegeneration.
Snippet: o bovine serum albumin (BSA)- blocked anti-His or anti-Flag-conjugated protein G Dynabeads (Invitrogen, 100-03D, HIS Cell Signaling Technology, #12698, FLAG M2, Sigma, F3165). Purified Syntaxin3-DDK (Origene, TP300658), SNAP29-DDK (Origene, TP302179), Syntaxin4 (Origene, TP300347), SNAP23-DDK (Origene, TP301596) or correspondingly SEC22B-HIS (Origene, AR50533PU-S) (100 ng) was used for the bindi
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products