OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARPC2 (NM_005731) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300319
Recombinant protein of human actin related protein 2/3 complex, subunit 2, 34kDa (ARPC2), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA308569 Rabbit Polyclonal antibody to ARPC2 (actin related protein 2/3 complex, subunit 2, 34kDa)
100 ul
$665.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ARPC2 or NM_005731"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200319 protein sequence
Red=Cloning site Green=Tags(s)

MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAH
GADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGEN
RAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELK
DTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRA
RPDAEKKEMKTITGKTFSSR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005722
Locus ID 10109
UniProt ID O15144
Cytogenetics 2q35
RefSeq Size 1419
RefSeq ORF 900
Synonyms ARC34; p34-Arc; PNAS-139; PRO2446
Summary This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Pathways Fc gamma R-mediated phagocytosis, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARPC2" proteins (5)
SKU Description Size Price
PH300319 ARPC2 MS Standard C13 and N15-labeled recombinant protein (NP_005722) 10 ug
$3,360.00
LC407180 Lyophilized ARPC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417111 Lyophilized ARPC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407180 Transient overexpression lysate of actin related protein 2/3 complex, subunit 2, 34kDa (ARPC2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY417111 Transient overexpression lysate of actin related protein 2/3 complex, subunit 2, 34kDa (ARPC2), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

Tumor-associated autoantibodies from mouse breast cancer models are found in serum of breast cancer patients
Stanton, Gad, Ramos et al
NPJ Breast Cancer (2021) 7 (1), 50 DOI: 10.1038/s41523-021-00257-1
Cited by 12
AI Summary: OriGene products, specifically the human VPS35 (Cat# RC222447), ARPC2 (Cat# RC202766), SERBP1 (Cat# RC202062), KRT8 (Cat# RC200181), and PDIA6 (Cat# RC200853) Myc-DDK-tagged ORF cDNA clones, were used to express and study the candidate tumor antigens whose autoantibody responses were analyzed in both mouse models and human breast cancer patient serum.
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products