OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SAM68 (KHDRBS1) (NM_006559) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300263
Recombinant protein of human KH domain containing, RNA binding, signal transduction associated 1 (KHDRBS1), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA377775 KHDRBS1/Sam68 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SAM68 or NM_006559"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200263 representing NM_006559
Red=Cloning site Green=Tags(s)

MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPS
ATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKD
DEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEE
ELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEP
SRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTA
GIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTR
PSLKAPPARPVKGAYREHPYGRY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 48 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006550
Locus ID 10657
UniProt ID Q07666
Cytogenetics 1p35.2
RefSeq Size 2685
RefSeq ORF 1329
Synonyms p62; p68; Sam68
Summary This gene encodes a member of the K homology domain-containing, RNA-binding, signal transduction-associated protein family. The encoded protein appears to have many functions and may be involved in a variety of cellular processes, including alternative splicing, cell cycle regulation, RNA 3'-end formation, tumorigenesis, and regulation of human immunodeficiency virus gene expression. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2012
Protein Categories Intracellular Proteins
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SAM68" proteins (3)
SKU Description Size Price
PH300263 KHDRBS1 MS Standard C13 and N15-labeled recombinant protein (NP_006550) 10 ug
$3,360.00
LC416574 Lyophilized KHDRBS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416574 Transient overexpression lysate of KH domain containing, RNA binding, signal transduction associated 1 (KHDRBS1) (as WB positive control) 100 ug
$436.00

file-alt Citations

A non-catalytic role of IPMK is required for PLCγ1 activation in T cell receptor signaling by stabilizing the PLCγ1-Sam68 complex
Hong, Kim, Shim et al
Cell Commun Signal (2024) 22 (1), 526 DOI: 10.1186/s12964-024-01907-0
Cited by 8
AI Summary: OriGene’s Flag-Sam68 purified protein (TP300263) was used in this study to investigate and confirm the interaction between Sam68 and other proteins involved in T cell receptor signaling, thereby elucidating IPMK’s role in stabilizing the PLCγ1-Sam68 complex.
Snippet: 500 ng of Flag-Sam68 purified protein (TP300263, OriGene) was incubated with 10 µL net volume of anti-Flag M2 beads in 0.1 M NaCl TGEM buffer (20 mM Tris-HCl, 20
FigureFigureFigure
Intronic tRNAs of mitochondrial origin regulate constitutive and alternative splicing
Hoser, Hoffmann, Meindl et al
Genome Biol (2020) 21 (1), 299 DOI: 10.1186/s13059-020-02199-6
Cited by 18
AI Summary: OriGene contributed to this study by providing the human recombinant KHDRBS1 (Sam68; CAT#: TP300263) protein, which was used to investigate protein interactions with nimtRNAs in the regulation of splicing.
Snippet: med as described in [47]. The expression construct was kindly provided by Douglas Black (University of California, Los Angeles, US). Human recombinant KHDRBS1 (Sam68;CAT#: TP300263) was ordered from Origene (Rockville, Maryland, USA). Search for genomic loci of nimtRNA genes Since there is no tool to accurately annotate MTLs, we tested different annotation strategies on genomic sequences of huma
FigureFigureFigure
Sam68 Allows Selective Targeting of Human Cancer Stem Cells
Benoit, Mitchell, Risueño et al
Cell Chem Biol (2017)
AI Summary: OriGene’s Recombinant Sam68 (TP300263) was used in this study to investigate the role of Sam68 in modulating Wnt/β-catenin signaling and promoting apoptosis and differentiation in human cancer stem cells.
Snippet: Targeting of human cancer stem cells (CSCs) requires the identification of vulnerabilities unique to CSCs versus healthy resident stem cells (SCs). Unfortunatel.;Recombinant Sam68, Origene, TP300263
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products