OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SCAMP2 (NM_005697) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300262
Recombinant protein of human secretory carrier membrane protein 2 (SCAMP2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA506991 SCAMP2 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SCAMP2 or NM_005697"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200262 protein sequence
Red=Cloning site Green=Tags(s)

MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPT
QPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTE
IPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAF
RSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSV
FLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 36.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005688
Locus ID 10066
UniProt ID O15127
Cytogenetics 15q24.1
RefSeq Size 1313
RefSeq ORF 987
Summary This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Alternate splicing results in multiple transcript variants. provided by RefSeq, Mar 2016
Protein Categories Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SCAMP2" proteins (3)
SKU Description Size Price
PH300262 SCAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_005688) 10 ug
$3,360.00
LC417127 Lyophilized SCAMP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417127 Transient overexpression lysate of secretory carrier membrane protein 2 (SCAMP2) (as WB positive control) 100 ug
$436.00

file-alt Citations

Targeting SCAMP2 by a natural product auxarconjugatin B for glioblastoma therapy via restoring aspartate metabolic flux
Shang, Li, Pu et al
Acta Pharmaceutica Sinica B (2026)
AI Summary: OriGene contributed to this study by providing the SCAMP2 full-length protein (catalog number TP300262M), which was used to investigate the interaction between auxarconjugatin B and SCAMP2 in glioblastoma research.
Snippet: by washing with a suitable buffer, after concentration and desalting to obtain recombinant SCAMP2 truncation and mutant. SCAMP2 full-length protein was purchased from OriGene Co., Ltd., Beijing, China (TP300262M)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products