UBE2C (NM_181801) Human Recombinant Protein
CAT#: TP300240
Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 4, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200240 protein sequence
Red=Cloning site Green=Tags(s) MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAA GTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLG EPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_861517 |
Locus ID | 11065 |
UniProt ID | O00762 |
Cytogenetics | 20q13.12 |
Refseq Size | 901 |
Refseq ORF | 540 |
Synonyms | dJ447F3.2; UBCH10 |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405592 | UBE2C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC416256 | UBE2C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405592 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 4 |
USD 436.00 |
|
LY416256 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 1 |
USD 436.00 |
|
PH300240 | UBE2C MS Standard C13 and N15-labeled recombinant protein (NP_861517) |
USD 3,255.00 |
|
PH308741 | UBE2C MS Standard C13 and N15-labeled recombinant protein (NP_008950) |
USD 3,255.00 |
|
TP308741 | Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 1, 20 µg |
USD 867.00 |
|
TP312704 | Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 5, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review