UBE2C (NM_007019) Human Mass Spec Standard

SKU
PH308741
UBE2C MS Standard C13 and N15-labeled recombinant protein (NP_008950)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208741]
Predicted MW 19.7 kDa
Protein Sequence
Protein Sequence
>RC208741 protein sequence
Red=Cloning site Green=Tags(s)

MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAA
GTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLG
EPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008950
RefSeq Size 864
RefSeq ORF 537
Synonyms dJ447F3.2; UBCH10
Locus ID 11065
UniProt ID O00762
Cytogenetics 20q13.12
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19. [provided by RefSeq, Aug 2013]
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:UBE2C (NM_007019) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300240 UBE2C MS Standard C13 and N15-labeled recombinant protein (NP_861517) 10 ug
$3,255.00
LC405592 UBE2C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416256 UBE2C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405592 Transient overexpression lysate of ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 4 100 ug
$436.00
LY416256 Transient overexpression lysate of ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 1 100 ug
$436.00
TP300240 Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 4, 20 µg 20 ug
$737.00
TP308741 Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 1, 20 µg 20 ug
$737.00
TP312704 Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 5, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.