UBE2C (NM_007019) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC208741] |
Predicted MW | 19.7 kDa |
Protein Sequence |
Protein Sequence
>RC208741 protein sequence
Red=Cloning site Green=Tags(s) MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAA GTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLG EPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_008950 |
RefSeq Size | 864 |
RefSeq ORF | 537 |
Synonyms | dJ447F3.2; UBCH10 |
Locus ID | 11065 |
UniProt ID | O00762 |
Cytogenetics | 20q13.12 |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300240 | UBE2C MS Standard C13 and N15-labeled recombinant protein (NP_861517) | 10 ug |
$3,255.00
|
|
LC405592 | UBE2C HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC416256 | UBE2C HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY405592 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 4 | 100 ug |
$436.00
|
|
LY416256 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 1 | 100 ug |
$436.00
|
|
TP300240 | Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
TP308741 | Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP312704 | Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 5, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.