GPR89B (NM_016334) Human Recombinant Protein

CAT#: TP300021

Purified recombinant protein of Human G protein-coupled receptor 89B (GPR89B), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg

Product Images

Purified recombinant protein GPR89B was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200021 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFLIDSSIMITSQILFFGFGWLFFMRQLFKDYEIRQYVVQVIFSVTFAFSCTMFELIIFEILGVLNSSS
  RYFHWKMNLCVILLILVFMVPFYIGYFIVSNIRLLHKQRLLFSCLLWLTFMYFFWKLGDPFPILSPKHGI
  LSIEQLISRVGVIGVTLMALLSGFGAVNCPYTYMSYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMA
  RRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKT
  FKGKYFNFLGYFFSIYCVWKIFMATINIVFDRVGKTDPVTRGIEITVNYLGIQFDVKFWSQHISFILVGI
  IIVTSIRGLLITLTKFFYAISSSKSSNVIVLLLAQIMGMYFVSSVLLIRMSMPLEYRTIITEVLGELQFN
  FYHRWFDVIFLVSALSSILFLYLAHKQAPEKQMAP
  
  myc-FLAG tag
• Tag: Myc-DDK
• Predicted MW: 52.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057418
• Locus ID: 51463
• UniProt ID: B7ZAQ6, P0CG08, X5D7G6
• Cytogenetics: 1q21.2
• Refseq Size: 2150
• Refseq ORF: 1365
• Synonyms: GPHR; GPR89; GPR89C; SH120; UNQ192
• Protein Families: Druggable Genome, GPCR, Transmembrane