GPR89B Rabbit Polyclonal Antibody

SKU TA337328

Rabbit Polyclonal Anti-GPR89A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GPR89A antibody is: synthetic peptide directed towards the C-terminal region of Human GPR89A. Synthetic peptide located within the following region: LEYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHKQAPEKQM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 53 kDa
• Gene Name: G protein-coupled receptor 89B
• Database Link:
  NP_057418
  B7ZAQ6
• Background: GPR89A is a nearly identical copy of the GPR89B gene.
• Synonyms: GPHR; GPR89; GPR89C; SH120; UNQ192
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane