OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SKIP (INPP5K) (NM_001135642) Human Mass Spec Standard

Be the first to review this product
SKU
PH327852
INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_001129114)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA377520 INPP5K Rabbit polyclonal Antibody
100 ul
$410.00
LY402561 Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SKIP or NM_001135642"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227852
Predicted MW 51.1 kDa
Protein Sequence
Protein Sequence
>RC227852 protein sequence
Red=Cloning site Green=Tags(s)

MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFND
SWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYG
YYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIK
NRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPC
AGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYS
STSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR
SVVGISRPFQIPPGSLREDPLGEAQPQI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129114
RefSeq Size 3391
RefSeq ORF 1344
Synonyms MDCCAID; PPS; SKIP
Locus ID 51763
UniProt ID Q9BT40
Cytogenetics 17p13.3
Summary This gene encodes a protein with 5-phosphatase activity toward polyphosphate inositol. The protein localizes to the cytosol in regions lacking actin stress fibers. It is thought that this protein may negatively regulate the actin cytoskeleton. Alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Oct 2008
Protein Families Druggable Genome, Phosphatase
Protein Pathways Inositol phosphate metabolism, Insulin signaling pathway, Metabolic pathways, Phosphatidylinositol signaling system
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SKIP" proteins (11)
SKU Description Size Price
PH300092 INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_057616) 10 ug
$3,360.00
PH312090 INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_570122) 10 ug
$3,360.00
LC402561 Lyophilized INPP5K HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408929 Lyophilized INPP5K HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427643 Lyophilized INPP5K HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402561 Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY408929 Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427643 Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP300092 Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, 20 µg 20 ug
$737.00
TP312090 Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, 20 µg 20 ug
$737.00
TP327852 Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products