SKIP (INPP5K) (NM_130766) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC212090] |
Predicted MW | 51.1 kDa |
Protein Sequence |
Protein Sequence
>RC212090 protein sequence
Red=Cloning site Green=Tags(s) MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFND SWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYG YYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIK NRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPC AGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYS STSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR SVVGISRPFQIPPGSLREDPLGEAQPQI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_570122 |
RefSeq Size | 3232 |
RefSeq ORF | 1344 |
Synonyms | MDCCAID; PPS; SKIP |
Locus ID | 51763 |
UniProt ID | Q9BT40 |
Cytogenetics | 17p13.3 |
Summary | This gene encodes a protein with 5-phosphatase activity toward polyphosphate inositol. The protein localizes to the cytosol in regions lacking actin stress fibers. It is thought that this protein may negatively regulate the actin cytoskeleton. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | Inositol phosphate metabolism, Insulin signaling pathway, Metabolic pathways, Phosphatidylinositol signaling system |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300092 | INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_057616) | 10 ug |
$3,255.00
|
|
PH327852 | INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_001129114) | 10 ug |
$3,255.00
|
|
LC402561 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC408929 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427643 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402561 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1 | 100 ug |
$436.00
|
|
LY408929 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2 | 100 ug |
$436.00
|
|
LY427643 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3 | 100 ug |
$436.00
|
|
TP300092 | Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP312090 | Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP327852 | Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.