SKIP (INPP5K) (NM_016532) Human Recombinant Protein

SKU
TP300092
Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200092 protein sequence
Red=Cloning site Green=Tags(s)

MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFND
SWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYG
YYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIK
NRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPC
AGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYS
STSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR
SVVGISRPFQIPPGSLREDPLGEAQPQI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057616
Locus ID 51763
UniProt ID Q9BT40
Cytogenetics 17p13.3
RefSeq Size 3001
RefSeq ORF 1344
Synonyms MDCCAID; PPS; SKIP
Summary This gene encodes a protein with 5-phosphatase activity toward polyphosphate inositol. The protein localizes to the cytosol in regions lacking actin stress fibers. It is thought that this protein may negatively regulate the actin cytoskeleton. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008]
Protein Families Druggable Genome, Phosphatase
Protein Pathways Inositol phosphate metabolism, Insulin signaling pathway, Metabolic pathways, Phosphatidylinositol signaling system
Write Your Own Review
You're reviewing:SKIP (INPP5K) (NM_016532) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300092 INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_057616) 10 ug
$3,255.00
PH312090 INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_570122) 10 ug
$3,255.00
PH327852 INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_001129114) 10 ug
$3,255.00
LC402561 INPP5K HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408929 INPP5K HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427643 INPP5K HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402561 Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1 100 ug
$436.00
LY408929 Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2 100 ug
$436.00
LY427643 Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3 100 ug
$436.00
TP312090 Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, 20 µg 20 ug
$737.00
TP327852 Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.