OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NECAP2 (NM_001145277) Human Mass Spec Standard

Be the first to review this product
SKU
PH327659
NECAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001138749)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344928 Rabbit Polyclonal Anti-NECAP2 Antibody - N-terminal region
100 ul
$585.00
LY428781 Transient overexpression lysate of NECAP endocytosis associated 2 (NECAP2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "NECAP2 or NM_001145277"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227659
Predicted MW 29.3 kDa
Protein Sequence
Protein Sequence
>RC227659 representing NM_001145277
Red=Cloning site Green=Tags(s)

MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQ
APVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQ
NPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVG
GSLVQPAVAPSSDQLPARPSQAQAGSSSDLSTVFPHVTSGKALPHLGQRKEDEALLSWPVFGA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138749
RefSeq ORF 819
Locus ID 55707
UniProt ID Q9NVZ3
Cytogenetics 1p36.13
Summary This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described. provided by RefSeq, Feb 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NECAP2" proteins (8)
SKU Description Size Price
PH327668 NECAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001138750) 10 ug
$3,360.00
LC428781 Lyophilized NECAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428782 Lyophilized NECAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY428781 Transient overexpression lysate of NECAP endocytosis associated 2 (NECAP2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428782 Transient overexpression lysate of NECAP endocytosis associated 2 (NECAP2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP327659 Recombinant protein of human NECAP endocytosis associated 2 (NECAP2), transcript variant 2, 20 µg 20 ug
$867.00
TP327668 Recombinant protein of human NECAP endocytosis associated 2 (NECAP2), transcript variant 3, 20 µg 20 ug
$867.00
TP721003 Purified recombinant protein of Human NECAP endocytosis associated 2 (NECAP2), transcript variant 1 10 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products