NECAP2 (NM_001145278) Human Mass Spec Standard

SKU
PH327668
NECAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001138750)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227668]
Predicted MW 25.1 kDa
Protein Sequence
Protein Sequence
>RC227668 representing NM_001145278
Red=Cloning site Green=Tags(s)

MEESGAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIE
DGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMK
KKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPAT
ADIWGDFTKSTGSTSSQTQPGTGWVQF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138750
RefSeq ORF 711
Locus ID 55707
UniProt ID Q9NVZ3
Cytogenetics 1p36.13
Summary This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009]
Write Your Own Review
You're reviewing:NECAP2 (NM_001145278) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH327659 NECAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001138749) 10 ug
$3,255.00
LC428781 NECAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428782 NECAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY428781 Transient overexpression lysate of NECAP endocytosis associated 2 (NECAP2), transcript variant 2 100 ug
$436.00
LY428782 Transient overexpression lysate of NECAP endocytosis associated 2 (NECAP2), transcript variant 3 100 ug
$436.00
TP327659 Recombinant protein of human NECAP endocytosis associated 2 (NECAP2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327668 Recombinant protein of human NECAP endocytosis associated 2 (NECAP2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721003 Purified recombinant protein of Human NECAP endocytosis associated 2 (NECAP2), transcript variant 1 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.