OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FXYD3 (NM_001136012) Human Mass Spec Standard

Be the first to review this product
SKU
PH327269
FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_001129484)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504717 FXYD3 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8) 100 ul
$447.00
LY411880 Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "FXYD3 or NM_001136012"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227269
Predicted MW 11.99 kDa
Protein Sequence
Protein Sequence
>RC227269 representing NM_001136012
Red=Cloning site Green=Tags(s)

MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSEWRSSGEQAGRG
WGSPPLTTQLSPTGAKCKCKFGQKSGHHPGETPPLITPGSAQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129484
RefSeq ORF 339
Synonyms MAT8; PLML
Locus ID 5349
UniProt ID Q14802
Cytogenetics 19q13.12
Summary This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms.provided by RefSeq, Oct 2008
Protein Families Ion Channels: Other, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FXYD3" proteins (14)
SKU Description Size Price
PH313945 FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_005962) 10 ug
$3,360.00
PH327235 FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_001129483) 10 ug
$3,360.00
LC411880 Lyophilized FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416954 Lyophilized FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427762 Lyophilized FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427763 Lyophilized FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411880 Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY416954 Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427762 Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 7 (as WB positive control) 100 ug
$436.00
LY427763 Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 8 (as WB positive control) 100 ug
$436.00
TP313945 Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1, 20 µg 20 ug
$867.00
TP327235 Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 7, 20 µg 20 ug
$867.00
TP327269 Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 8, 20 µg 20 ug
$867.00
TP761868 Purified recombinant protein of Human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products