FXYD3 (NM_005971) Human Mass Spec Standard

SKU PH313945

FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_005962)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC213945]
• Predicted MW: 9.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC213945 protein sequence; Red=Cloning site Green=Tags(s); ; MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSG; HHPGETPPLITPGSAQS; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_005962
• RefSeq Size: 1382
• RefSeq ORF: 261
• Synonyms: MAT8; PLML
• Locus ID: 5349
• UniProt ID: Q14802
• Cytogenetics: 19q13.12
• Summary: This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2008]
• Protein Families: Ion Channels: Other, Transmembrane