FXYD3 (NM_001136011) Human Mass Spec Standard

SKU
PH327235
FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_001129483)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227235]
Predicted MW 9.3 kDa
Protein Sequence
Protein Sequence
>RC227235 protein sequence
Red=Cloning site Green=Tags(s)

MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSG
HHPGETPPLITPGSAQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129483
RefSeq Size 1466
RefSeq ORF 261
Synonyms MAT8; PLML
Locus ID 5349
UniProt ID Q14802
Cytogenetics 19q13.12
Summary This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2008]
Protein Families Ion Channels: Other, Transmembrane
Write Your Own Review
You're reviewing:FXYD3 (NM_001136011) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH313945 FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_005962) 10 ug
$3,255.00
PH327269 FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_001129484) 10 ug
$3,255.00
LC411880 FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416954 FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427762 FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427763 FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411880 Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 2 100 ug
$436.00
LY416954 Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1 100 ug
$436.00
LY427762 Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 7 100 ug
$436.00
LY427763 Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 8 100 ug
$436.00
TP313945 Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1, 20 µg 20 ug
$867.00
TP327235 Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 7, 20 µg 20 ug
$867.00
TP327269 Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 8, 20 µg 20 ug
$867.00
TP761868 Purified recombinant protein of Human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.