OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SCRN1 (NM_001145513) Human Mass Spec Standard

Be the first to review this product
SKU
PH327072
SCRN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138985)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA507264 SCRN1 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2) 100 ul
$447.00
LY414994 Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SCRN1 or NM_001145513"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227072
Predicted MW 46.4 kDa
Protein Sequence
Protein Sequence
>RC227072 protein sequence
Red=Cloning site Green=Tags(s)

MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEPESKVECTYISIDQVPRTYAIMI
SRPAWLWGAEMGANEHGVCIANEAINTREPAAEIEALLGMDLVRLGLERGETAKEALDVIVSLLEEHGQG
GNYFEDANSCHSFQSAYLIVDRDEAWVLETIGKYWAAEKVTEGVRCICSQLSLTTKMDAEHPELRSYAQS
QGWWTGEGEFNFSEVFSPVEDHLDCGAGKDSLEKQEESITVQTMMNTLRDKASGVCIDSEFFLTTASGVS
VLPQNRSSPCIHYFTGTHDPSRSIFKPFIFVDDVKLVPKTQSPCFGDDDPAKKEPRFQEKPDRRHELYKA
HEWARAIIESDQEQGRKLRSTMLELEKQGLEAMEEILTSSEPLDPAEVGDLFYDCVDTEIKFFK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138985
RefSeq Size 5286
RefSeq ORF 1242
Synonyms SES1
Locus ID 9805
UniProt ID Q12765
Cytogenetics 7p14.3
Summary This gene likely encodes a member of the secernin family of proteins. A similar protein in rat functions in regulation of exocytosis in mast cells. Alternatively spliced transcript variants have been described. provided by RefSeq, Mar 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SCRN1" proteins (11)
SKU Description Size Price
PH306268 SCRN1 MS Standard C13 and N15-labeled recombinant protein (NP_055581) 10 ug
$3,360.00
LC414994 Lyophilized SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428918 Lyophilized SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428919 Lyophilized SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428920 Lyophilized SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414994 Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428918 Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428919 Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY428920 Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP306268 Recombinant protein of human secernin 1 (SCRN1), transcript variant 2, 20 µg 20 ug
$867.00
TP327072 Recombinant protein of human secernin 1 (SCRN1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products