SCRN1 (NM_014766) Human Mass Spec Standard

SKU
PH306268
SCRN1 MS Standard C13 and N15-labeled recombinant protein (NP_055581)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206268]
Predicted MW 46.4 kDa
Protein Sequence
Protein Sequence
>RC206268 protein sequence
Red=Cloning site Green=Tags(s)

MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEPESKVECTYISIDQVPRTYAIMI
SRPAWLWGAEMGANEHGVCIANEAINTREPAAEIEALLGMDLVRLGLERGETAKEALDVIVSLLEEHGQG
GNYFEDANSCHSFQSAYLIVDRDEAWVLETIGKYWAAEKVTEGVRCICSQLSLTTKMDAEHPELRSYAQS
QGWWTGEGEFNFSEVFSPVEDHLDCGAGKDSLEKQEESITVQTMMNTLRDKASGVCIDSEFFLTTASGVS
VLPQNRSSPCIHYFTGTHDPSRSIFKPFIFVDDVKLVPKTQSPCFGDDDPAKKEPRFQEKPDRRHELYKA
HEWARAIIESDQEQGRKLRSTMLELEKQGLEAMEEILTSSEPLDPAEVGDLFYDCVDTEIKFFK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055581
RefSeq Size 5278
RefSeq ORF 1242
Synonyms SES1
Locus ID 9805
UniProt ID Q12765
Cytogenetics 7p14.3
Summary This gene likely encodes a member of the secernin family of proteins. A similar protein in rat functions in regulation of exocytosis in mast cells. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]
Write Your Own Review
You're reviewing:SCRN1 (NM_014766) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH327072 SCRN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138985) 10 ug
$3,255.00
LC414994 SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428918 SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428919 SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428920 SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414994 Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 2 100 ug
$436.00
LY428918 Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 1 100 ug
$436.00
LY428919 Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 3 100 ug
$436.00
LY428920 Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 4 100 ug
$436.00
TP306268 Recombinant protein of human secernin 1 (SCRN1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327072 Recombinant protein of human secernin 1 (SCRN1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.