SCRN1 (NM_014766) Human Recombinant Protein

SKU
TP306268
Recombinant protein of human secernin 1 (SCRN1), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206268 protein sequence
Red=Cloning site Green=Tags(s)

MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEPESKVECTYISIDQVPRTYAIMI
SRPAWLWGAEMGANEHGVCIANEAINTREPAAEIEALLGMDLVRLGLERGETAKEALDVIVSLLEEHGQG
GNYFEDANSCHSFQSAYLIVDRDEAWVLETIGKYWAAEKVTEGVRCICSQLSLTTKMDAEHPELRSYAQS
QGWWTGEGEFNFSEVFSPVEDHLDCGAGKDSLEKQEESITVQTMMNTLRDKASGVCIDSEFFLTTASGVS
VLPQNRSSPCIHYFTGTHDPSRSIFKPFIFVDDVKLVPKTQSPCFGDDDPAKKEPRFQEKPDRRHELYKA
HEWARAIIESDQEQGRKLRSTMLELEKQGLEAMEEILTSSEPLDPAEVGDLFYDCVDTEIKFFK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 46.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055581
Locus ID 9805
UniProt ID Q12765
Cytogenetics 7p14.3
RefSeq Size 5278
RefSeq ORF 1242
Synonyms SES1
Summary This gene likely encodes a member of the secernin family of proteins. A similar protein in rat functions in regulation of exocytosis in mast cells. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]
Write Your Own Review
You're reviewing:SCRN1 (NM_014766) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306268 SCRN1 MS Standard C13 and N15-labeled recombinant protein (NP_055581) 10 ug
$3,255.00
PH327072 SCRN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138985) 10 ug
$3,255.00
LC414994 SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428918 SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428919 SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428920 SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414994 Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 2 100 ug
$436.00
LY428918 Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 1 100 ug
$436.00
LY428919 Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 3 100 ug
$436.00
LY428920 Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 4 100 ug
$436.00
TP327072 Recombinant protein of human secernin 1 (SCRN1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.