OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

YAP1 (NM_001130145) Human Mass Spec Standard

Be the first to review this product
SKU
PH325864
YAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001123617)
Size:
10 ug
  $3,360.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA336916 Mouse Monoclonal YAP1 Antibody (1A12)
100 ul
$620.00
LY401842 Transient overexpression lysate of Yes-associated protein 1, 65kDa (YAP1), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "YAP1 or NM_001130145"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225864
Predicted MW 54.3 kDa
Protein Sequence
Protein Sequence
>RC225864 representing NM_001130145
Red=Cloning site Green=Tags(s)

MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFN
AVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPG
TLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQM
NVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVK
QPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRS
QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV
DEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVL
AATKLDKESFLTWL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001123617
RefSeq ORF 1512
Synonyms COB1; YAP; YAP2; YAP65; YKI
Locus ID 10413
UniProt ID P46937
Cytogenetics 11q22.1
Summary This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Aug 2013
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "YAP1" proteins (5)
SKU Description Size Price
LC401842 Lyophilized YAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434268 Lyophilized YAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401842 Transient overexpression lysate of Yes-associated protein 1, 65kDa (YAP1), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY434268 Transient overexpression lysate of Yes-associated protein 1 (YAP1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP325864 Purified recombinant protein of Homo sapiens Yes-associated protein 1, 65kDa (YAP1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products