OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Bcl2 Binding component 3 (BBC3) (NM_001127240) Human Mass Spec Standard

Be the first to review this product
SKU
PH325345
BBC3 MS Standard C13 and N15-labeled recombinant protein (NP_001120712)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA321834 Anti-BBC3 Rabbit Polyclonal Antibody
100 ul
$305.00
LY402330 Transient overexpression lysate of BCL2 binding component 3 (BBC3), transcript variant 4 (as WB positive control) 100 ug
$436.00

Other products for "Bcl2 Binding component 3 or NM_001127240"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225345
Predicted MW 26.3 kDa
Protein Sequence
Protein Sequence
>RC225345 representing NM_001127240
Red=Cloning site Green=Tags(s)

MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSV
LRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGV
ARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHH
GTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001120712
RefSeq ORF 783
Synonyms JFY-1; JFY1; PUMA
Locus ID 27113
UniProt ID Q96PG8
Cytogenetics 19q13.32
Summary This gene encodes a member of the BCL-2 family of proteins. This family member belongs to the BH3-only pro-apoptotic subclass. The protein cooperates with direct activator proteins to induce mitochondrial outer membrane permeabilization and apoptosis. It can bind to anti-apoptotic Bcl-2 family members to induce mitochondrial dysfunction and caspase activation. Because of its pro-apoptotic role, this gene is a potential drug target for cancer therapy and for tissue injury. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2011
Protein Families Druggable Genome
Protein Pathways Huntington's disease, p53 signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Bcl2 Binding component 3" proteins (7)
SKU Description Size Price
PH313203 BBC3 MS Standard C13 and N15-labeled recombinant protein (NP_055232) 10 ug
$3,360.00
LC402330 Lyophilized BBC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426734 Lyophilized BBC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402330 Transient overexpression lysate of BCL2 binding component 3 (BBC3), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY426734 Transient overexpression lysate of BCL2 binding component 3 (BBC3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP313203 Recombinant protein of human BCL2 binding component 3 (BBC3), transcript variant 4, 20 µg 20 ug
$867.00
TP325345 Recombinant protein of human BCL2 binding component 3 (BBC3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products