OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CLDN19 (NM_001123395) Human Mass Spec Standard

Be the first to review this product
SKU
PH325251
CLDN19 MS Standard C13 and N15-labeled recombinant protein (NP_001116867)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322029 Anti-CLDN19 Rabbit Polyclonal Antibody
100 ul
$305.00
LY407723 Transient overexpression lysate of claudin 19 (CLDN19), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CLDN19 or NM_001123395"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225251
Predicted MW 21.9 kDa
Protein Sequence
Protein Sequence
>RC225251 representing NM_001123395
Red=Cloning site Green=Tags(s)

MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSL
LALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGLCTLTAVSWY
ATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREY
V

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001116867
RefSeq ORF 633
Synonyms HOMG5
Locus ID 149461
UniProt ID Q8N6F1
Cytogenetics 1p34.2
Summary The product of this gene belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO). HOMGO is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis associated with severe ocular abnormalities such as bilateral chorioretinal scars, macular colobomata, significant myopia and nystagmus. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. provided by RefSeq, Jun 2010
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CLDN19" proteins (7)
SKU Description Size Price
PH316887 CLDN19 MS Standard C13 and N15-labeled recombinant protein (NP_683763) 10 ug
$3,360.00
LC407723 Lyophilized CLDN19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426624 Lyophilized CLDN19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407723 Transient overexpression lysate of claudin 19 (CLDN19), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426624 Transient overexpression lysate of claudin 19 (CLDN19), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP316887 Recombinant protein of human claudin 19 (CLDN19), transcript variant 1, 20 µg 20 ug
$737.00
TP325251 Recombinant protein of human claudin 19 (CLDN19), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products