CLDN19 (NM_148960) Human Mass Spec Standard

SKU
PH316887
CLDN19 MS Standard C13 and N15-labeled recombinant protein (NP_683763)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216887]
Predicted MW 23.2 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC216887
Blue=ORF Red=Cloning site Green=Tag(s)

MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDS
LLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGLCTLTAVS
WYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAA
REPVVKLPASAKGPLGV

myc-FLAG tag

Recombinant protein using RC216887 also available, TP316887
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_683763
RefSeq Size 2859
RefSeq ORF 672
Synonyms HOMG5
Locus ID 149461
UniProt ID Q8N6F1
Cytogenetics 1p34.2
Summary The product of this gene belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO). HOMGO is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis associated with severe ocular abnormalities such as bilateral chorioretinal scars, macular colobomata, significant myopia and nystagmus. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jun 2010]
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction
Write Your Own Review
You're reviewing:CLDN19 (NM_148960) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH325251 CLDN19 MS Standard C13 and N15-labeled recombinant protein (NP_001116867) 10 ug
$3,255.00
LC407723 CLDN19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426624 CLDN19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407723 Transient overexpression lysate of claudin 19 (CLDN19), transcript variant 1 100 ug
$436.00
LY426624 Transient overexpression lysate of claudin 19 (CLDN19), transcript variant 2 100 ug
$436.00
TP316887 Recombinant protein of human claudin 19 (CLDN19), transcript variant 1, 20 µg 20 ug
$737.00
TP325251 Recombinant protein of human claudin 19 (CLDN19), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.